Protein Info for HMPREF1078_RS13635 in Parabacteroides merdae CL09T00C40

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF03786: UxuA" amino acids 5 to 382 (378 residues), 447.6 bits, see alignment E=2.6e-138 TIGR00695: mannonate dehydratase" amino acids 5 to 386 (382 residues), 596.3 bits, see alignment E=1.5e-183 PF01261: AP_endonuc_2" amino acids 204 to 345 (142 residues), 39.9 bits, see alignment E=4.2e-14

Best Hits

Swiss-Prot: 81% identical to UXUA_BACTN: Mannonate dehydratase (uxuA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 85% identity to pdi:BDI_0376)

MetaCyc: 63% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>HMPREF1078_RS13635 mannonate dehydratase (Parabacteroides merdae CL09T00C40)
MYLCEQTWRWYGPNDPVSLSDIRQAGATGIVNALHHIPNGEVWTVEEIQKRKDMIEAAGL
RWSVVESVPVHEHIKTQSGDFQKYIDNYKESIRNLAACDIRVITYNFMPVLDWTRTNLAY
TMPDGSKALRFERAAFMAFDLYILKRPAAEQEYTDEEKAIAKARFDEMSEDDKALLVRNM
IAGLPGSEESFTLDQFRAELDRYKDIDAERLRANLIYFLKEITPVADEVGARMVIHPDDP
PYSILGLPRILSTEEDFRKLIEAVPNKSNGLCLCTGSFGVRGDNDLAGMMKRFGDRIDFV
HIRSTKRDEAGNFFEANLLEGDVNVYEVMKALLEIEQERGCSIAMRPDHGHQMIDDLHKK
TNPGYSCIGRLRSLAELRGLELGIACSLFK