Protein Info for HMPREF1078_RS13570 in Parabacteroides merdae CL09T00C40

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
  • amino acids 4 to 234 (231 residues), 244.6 bits, E=5.1e-77
• PF00977: His_biosynth
  • amino acids 4 to 230 (227 residues), 245.8 bits, E=2e-77

Best Hits

Swiss-Prot: 87% identical to HIS4_PARD8: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 87% identity to pdi:BDI_2017)

MetaCyc: 36% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Protein Sequence (239 amino acids)

>HMPREF1078_RS13570 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase (Parabacteroides merdae CL09T00C40)
MIELIPAIDMIDGKCVRLTQGDYNTKKVYNEDPLEVAKMFEDHGIRRLHVVDLDGARQGR
IINYRMLERLATRTSLIIDFGGGLKQEGDLEIAFESGAQMVTGGSIAVKNPEIFTSWITK
FGPEKIILGADVKDKKIAISGWEETTDKELIPFIHDYYDNGITKTICTDINRDGMLQGPA
IELYKEIQEQIPLLYLIASGGISSIQDIEKLAEAGIPAVIFGKAIYEGKIQLKDLIRFT