Protein Info for HMPREF1078_RS13565 in Parabacteroides merdae CL09T00C40

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 250 (250 residues), 348.9 bits, E=7.2e-109
• PF00977: His_biosynth
  • amino acids 5 to 233 (229 residues), 263 bits, E=4.4e-82
• PF01207: Dus
  • amino acids 65 to 117 (53 residues), 26.5 bits, E=7e-10

Best Hits

Swiss-Prot: 91% identical to HIS6_PARD8: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 91% identity to pdi:BDI_2018)

MetaCyc: 56% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Protein Sequence (251 amino acids)

>HMPREF1078_RS13565 imidazole glycerol phosphate synthase subunit HisF (Parabacteroides merdae CL09T00C40)
MLAKRIVPCLDIKDGKTVKGINFVNFRDAGDPVELGAQYSREGADELVYLDITASHEGRK
TFTELVKKVAANISIPFTVGGGINELKDVDRLLSAGADKVSINSAALRNPKLIEEIAKNF
GSQVCVVAIDANFEMGDWICYLNGGRIPTEKHLFQWAAEAESLGAGEILFTSMTHDGVKD
GYANEALAMLADNLHIPVIASGGAGKMEHFRDTFAQGKADAALAASVFHFGEIGIGALKQ
YLHEEGINVRL