Protein Info for HMPREF1078_RS13555 in Parabacteroides merdae CL09T00C40
Annotation: ATP-binding cassette domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 42% identical to FTSE_BACSU: Cell division ATP-binding protein FtsE (ftsE) from Bacillus subtilis (strain 168)
KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 87% identity to pdi:BDI_2020)Predicted SEED Role
"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (225 amino acids)
>HMPREF1078_RS13555 ATP-binding cassette domain-containing protein (Parabacteroides merdae CL09T00C40) MEETTLLKLDKVDICREENVILHRASFTLHNGEFVYVIGKVGSGKSSLLKSLYCEIPINQ GDAWLLDYNLCKMRRKDIPYLRRKLGIVFQDFQLLTDRSVHKNLEFVLKATGWKKKSEIN ERINNVLFQVGMQDKGYKMPHELSGGEQQRIVIARALLNDPVLILADEPTGNLDPETSGQ IVQLLHDICRKGTAVIMTTHNYTLVHNYPARIVKCENACLSDVGE