Protein Info for HMPREF1078_RS13545 in Parabacteroides merdae CL09T00C40

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR01048: diaminopimelate decarboxylase" amino acids 13 to 378 (366 residues), 415.7 bits, see alignment E=7.8e-129 PF00278: Orn_DAP_Arg_deC" amino acids 19 to 362 (344 residues), 93 bits, see alignment E=1.7e-30 PF01168: Ala_racemase_N" amino acids 27 to 222 (196 residues), 26.8 bits, see alignment E=6.1e-10 PF02784: Orn_Arg_deC_N" amino acids 31 to 274 (244 residues), 200.2 bits, see alignment E=5.6e-63

Best Hits

Swiss-Prot: 65% identical to DCDA_BACTN: Diaminopimelate decarboxylase (lysA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 86% identity to pdi:BDI_2022)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>HMPREF1078_RS13545 diaminopimelate decarboxylase (Parabacteroides merdae CL09T00C40)
MILKGTFPTEKFKSLATPFYFYDITLLKETLNTVKTEAGKYGYHVHYAVKANANPRILSI
IAEYGLGADCVSGGEIQAALDAGFPARKIVYAGVGKADWEINLGLDNDIFCFNVESAAEL
EILEELAAAKNKVASIALRINPEVDAHTHAKITTGMKENKFGINLSQLGQVLDLVCRLEH
IKLIGIHCHIGSQITDMAAFRGLVIRVNEIQEELEARGIKVENLNFGGGLGIDYYHPNHL
PIPAFDNYFAVFNKLLQLRPGQQVHFEPGRSIVAQCGSLISKVLYVKVGETKKFCILDAG
FTELIRPAMYDAYHRMENITSDEEVEVYDVVGPICESSDVFGKDVELNRAHRGDLIALRS
AGAYGEVMASQYNCRKLPTAHYSDTM