Protein Info for HMPREF1078_RS13415 in Parabacteroides merdae CL09T00C40

Annotation: LuxR C-terminal-related transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 51 to 68 (18 residues), see Phobius details amino acids 169 to 184 (16 residues), see Phobius details PF00196: GerE" amino acids 125 to 176 (52 residues), 62.3 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 73% identity to pdi:BDI_3841)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>HMPREF1078_RS13415 LuxR C-terminal-related transcriptional regulator (Parabacteroides merdae CL09T00C40)
MHRNKQIAIILSDTLQSIGLQSMLTDYFPPVEISHYPTFEAFSTSGNDTFDYYFTNAALF
VLYADFFLPRRSKTMVLIDETEGEGGLSATSHITIKASQEVIIEQLEQLFTGENNSISSD
NNKELSTRETDVLQLIVKGSTNKEIADKLNISLNTVLSHRKNITTKLGIKTVSGLTFYAI
MNGIISGDDIEL