Protein Info for HMPREF1078_RS13395 in Parabacteroides merdae CL09T00C40

Annotation: oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 2 to 453 (452 residues), 472.1 bits, see alignment E=9.5e-146 PF04055: Radical_SAM" amino acids 53 to 224 (172 residues), 74.8 bits, see alignment E=9.5e-25 PF06969: HemN_C" amino acids 360 to 432 (73 residues), 36.4 bits, see alignment E=4.3e-13

Best Hits

Swiss-Prot: 40% identical to HEMN_AQUAE: Oxygen-independent coproporphyrinogen III oxidase (hemN) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 61% identity to bhl:Bache_2770)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>HMPREF1078_RS13395 oxygen-independent coproporphyrinogen III oxidase (Parabacteroides merdae CL09T00C40)
MKQELLDKYNVPVPRYTSYPPANYFHDGFTSRDYADAIRESNRQQPESVSFYFHIPFCQR
LCHYCGCNSYAAPKPEIIDRYVAALHKEIDLILPLLDKKRKVSQIHYGGGTPTFLPALEL
KELNAHVSDTFELIENPEKAIECHPGWMTGQDWEKLATAGFNRFSIGIQDFNKQVLQTVH
RQTPLLQPEEIVTILRSYGVRINMDFLYGLPHQTEASFAETIEKAVSLKPDRLVTFSYAH
VPWAFPRQKVLEKTGLPSGDEKSRMFEAARKILCEADYQPIGLDHFVRKDDELYTALLNG
QLHRNFQGYCTRRTTGQVYAFGVTGISQLGTAYAQNTKDIMEYIEKVEAGILPVAKGYLL
SREEQITREAIEMLMCNYRIDWNELSEQLSVPARSIKQATAYDEACLREFAEDGLVEFDE
NQIRMTPEGRLFVRNVAASLDKLMLGTNKSFSKPV