Protein Info for HMPREF1078_RS13135 in Parabacteroides merdae CL09T00C40

Annotation: adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR00184: adenylosuccinate synthase" amino acids 5 to 418 (414 residues), 508.6 bits, see alignment E=6.6e-157 PF00709: Adenylsucc_synt" amino acids 5 to 417 (413 residues), 574.1 bits, see alignment E=7.8e-177

Best Hits

Swiss-Prot: 90% identical to PURA_PARD8: Adenylosuccinate synthetase (purA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 90% identity to pdi:BDI_3782)

MetaCyc: 46% identical to Ade12 (Saccharomyces cerevisiae)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>HMPREF1078_RS13135 adenylosuccinate synthase (Parabacteroides merdae CL09T00C40)
MKVDVLLGLQWGDEGKGKVVDVLTPNYDVITRFQGGPNAGHTLEFNGEKYVLRSIPSGIF
QGGKVNVIGNGVVLDPLLFQQEAEALAASGHDLTKQLCISKKAHLILPTHRILDAAYEAA
KGSGKIGTTGKGIGPTYTDKISRNGLRVGDLLHNFDEKYAAAKARHEAILRSLNYEYDIT
ELEAQWFKALDYLKQFRLIDSEHVINNYLKEGKSVLAEGAQGTMLDIDFGSYPFVTSSNT
ICAGCCTGLGVSPRNIGEVYGIFKAYCTRVGSGPFPTELFDETGSKIRQIGHEYGAVTGR
ERRCGWIDLVALKYAIMINGVTKLIMMKSDVLDGFETVKACIAYKVNGEETTEFPFEINE
GIEPVYVEMPGWNVDMTKMQSEDEFPEEFNAYISFLEEELEVPIKIVSVGPDREQTIVRY
TEE