Protein Info for HMPREF1078_RS13110 in Parabacteroides merdae CL09T00C40

Annotation: gamma carbonic anhydrase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 12 to 46 (35 residues), 36.6 bits, 3.7e-13
  • amino acids 90 to 123 (34 residues), 33.5 bits, 3.5e-12
• PF21711: DCTN5
  • amino acids 41 to 163 (123 residues), 30.5 bits, E=4.2e-11
• PF14602: Hexapep_2
  • amino acids 74 to 105 (32 residues), 22.3 bits, 1.4e-08

Best Hits

Swiss-Prot: 50% identical to YTOA_BACSU: Uncharacterized transferase YtoA (ytoA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to pdi:BDI_2284)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• superpathway of arginine and polyamine biosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Protein Sequence (173 amino acids)

>HMPREF1078_RS13110 gamma carbonic anhydrase family protein (Parabacteroides merdae CL09T00C40)
MALIKSVRGFTPQIGKDTFLADNATIIGDVEIGEGCSIWFGTVLRGDVNSIRIGNGVNIQ
DGSVLHTLYEKSTIEIGDDVSVGHNVTIHGAKICNGALIGMGSVVLDHAVIGEGAIVAAG
SVVLSKTIVEPGSIYAGIPAKFVKKVDPEQAKEINQKIAKNYHMYSSWYKEEH