Protein Info for HMPREF1078_RS13015 in Parabacteroides merdae CL09T00C40

Annotation: Holliday junction branch migration protein RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 196 (196 residues), 150.2 bits, see alignment E=2.4e-48 PF01330: RuvA_N" amino acids 1 to 61 (61 residues), 70.4 bits, see alignment E=2.2e-23 PF14520: HHH_5" amino acids 71 to 128 (58 residues), 53.1 bits, see alignment E=7.4e-18 PF07499: RuvA_C" amino acids 152 to 195 (44 residues), 41.3 bits, see alignment 3.6e-14

Best Hits

Swiss-Prot: 83% identical to RUVA_PARD8: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 83% identity to pdi:BDI_2660)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>HMPREF1078_RS13015 Holliday junction branch migration protein RuvA (Parabacteroides merdae CL09T00C40)
MIEYIKGEIVELTPARMILECAGIGYELNISLNTYTFYNGKPTGKIYVYEVIREDAHLLF
GFAGKDERELFLMLTSVSGVGPNTARMILSSLSPSELIRVIADKNETALTSVKGIGLKTA
QRILVDLKNKVKPIEGMTVTGGSSSVAASGAVTEEAVAALVMLGFQKAASQKAVNLILKG
SPALAVEQVIKTALRML