Protein Info for HMPREF1078_RS13010 in Parabacteroides merdae CL09T00C40

Annotation: TrkH family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 457 to 481 (25 residues), see Phobius details PF02386: TrkH" amino acids 65 to 475 (411 residues), 198.1 bits, see alignment E=1.1e-62

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 80% identity to pdi:BDI_2662)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>HMPREF1078_RS13010 TrkH family potassium uptake protein (Parabacteroides merdae CL09T00C40)
MLNIRFIIKMLGMMFILETLFMLAATAVAFLYEGNDFYPLLQSSGIMFGTGVLFMLIGLR
ANEHTAGRREGMLTVTLTWALFSLLGMLPFYLGGYIDNVTDAYFETMSGFTTTGSTILTD
IEALPHGILFWRSLTQWQGGIGMIVFTVALMPIIGGGATQMFNAETPGITHERFRPRVTQ
VAKRLWGVYLFLTIILIGLLWAGPMDLYDAVNHALTCISTGGYSTKNASIAYWDSAYIEY
TITIFMFIGATNITLIYFFFNGRPKKLFADEETRWFFWFVLIITAISTVWIMYKGIVDDF
GTAFRQTVFQVVTLVSTCGFATVDYIPWGPFFWLLALVLMVVCGCAGSTCGGLKMGRFVI
LTKNLFNEFKKQTHPHAIIPVRMNGHAVSGDIVHRVLAFAFAYIALIFVSCMVLMIDGVG
FEETIGATISSISNVGPGLGSLGPVGNYADVPVVSKWFLSFLMMVGRLEIFTVLTILLPG
FWKQ