Protein Info for HMPREF1078_RS13005 in Parabacteroides merdae CL09T00C40

Annotation: Trk system potassium transporter TrkA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF02254: TrkA_N" amino acids 3 to 123 (121 residues), 77.9 bits, see alignment E=2.3e-25 amino acids 231 to 346 (116 residues), 74.7 bits, see alignment E=2.3e-24 PF03807: F420_oxidored" amino acids 3 to 92 (90 residues), 22.8 bits, see alignment E=3.5e-08 PF02080: TrkA_C" amino acids 154 to 218 (65 residues), 48.4 bits, see alignment E=2.1e-16 amino acids 377 to 444 (68 residues), 37.5 bits, see alignment E=5.3e-13

Best Hits

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 93% identity to pdi:BDI_2663)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>HMPREF1078_RS13005 Trk system potassium transporter TrkA (Parabacteroides merdae CL09T00C40)
MKIIIAGAGEVGTHLAKMLSQEKQDIILMDPNEERLNFTNSSMEILPMVGNPTSIRDLEE
AGIRKADLFVSVTPEETTNVAASILASKLGAHKTLARINNYEYLLPKNKELFEKMGIDSM
IYPEMLAAKEIVTAVRRPWTRQYWELFGGALILIGVKVRDNSRLVNKHLSELLNEQKLYH
IVAIKRQNETIIPRGTDRIESGDIVFFTTTKSHIEDVRLHAGKRDPEVKKVIIMGGSRIA
IRTCQYLPNNIRVKVIETNKEKSHRIAEVVPGNVLIINGDGRDTDLLMQEGIKDAQAFIA
LTDNSSTNILACLAAKRAGVFKTIAKIENIDYIPLAESMDIGSVINKKLIAASHIYQFLL
DADVSNVKCLTFANADVAELVARPDSKITRKQVKDLNLPKDLTLGGLIRDGEPMMIKGDT
HIQAYDHVVVFCLDTAMRKLEDYFN