Protein Info for HMPREF1078_RS13000 in Parabacteroides merdae CL09T00C40

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 10 to 287 (278 residues), 369.1 bits, E=2.7e-114
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 11 to 632 (622 residues), 726.3 bits, E=1.6e-222
• PF02775: TPP_enzyme_C
  • amino acids 116 to 182 (67 residues), 22 bits, E=2.5e-08
• PF02779: Transket_pyr
  • amino acids 328 to 487 (160 residues), 124.7 bits, E=6.7e-40
• PF02780: Transketolase_C
  • amino acids 503 to 624 (122 residues), 94 bits, E=1.3e-30

Best Hits

Swiss-Prot: 88% identical to DXS_PARD8: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 88% identity to pdi:BDI_2664)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (3/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (2/6 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (635 amino acids)

>HMPREF1078_RS13000 1-deoxy-D-xylulose-5-phosphate synthase (Parabacteroides merdae CL09T00C40)
MTECKDEHILNSIDYPEDLRKLSPDKLGEVCAELRQYIIDVLSENPGHLGASLGTVELTV
ALHYVFNTPYDRIVWDVGHQAYGHKILTGRREAFHTLRKFKGISGFPNPLESPYDAFVAG
HASNSISAAMGMSVASALKGEKDRHVIAVIGDGAMTGGLAFEGLNNASANPNNLLIILND
NDMAIDHAVGGLSQYLVDITTSQAYNKMRYDVYRGLRKMKLINNDRRGNILRFNNSLKAL
LTQQHNLFEGFSIRYFGPIDGHDVGYMIKVLNDIKDMEGPKLLHIKTKKGKGFKPAEKSA
TEWHAPGLFNKETGERIIVHKLNEPQLYQDVFGHTLVELAEQDERIVGVTPAMPTGCSMT
YMMKAFPKRAFDVGIAEGHSVTFSAGLAKEGMIPFCNVYSSFMQRAYDMVIHDVALQNLH
MVICLDRAGLVGEDGATHHGVFDLAYLRPVPNLVISSPLNELDLRNLMYTGYKECNGPFV
IRYPRGKGEMADWRNEMHILPIGKGKKLRDGDDIAILSLGPIGNEVIKAIKEVESDGISI
AHYDMIFLKPMDEELLHEVGKRFSRVITVENGVIKGGLGSAVLEFMADNGYAPQVKRIGV
PDEFVEHGSIPELYKLCGMDAKSIAGEIKKMVIRG