Protein Info for HMPREF1078_RS12745 in Parabacteroides merdae CL09T00C40

Annotation: triose-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 5 to 250 (246 residues), 315 bits, E=1.8e-98
• TIGR00419: triose-phosphate isomerase
  • amino acids 5 to 240 (236 residues), 200 bits, E=2.3e-63

Best Hits

Swiss-Prot: 96% identical to TPIS_PARD8: Triosephosphate isomerase (tpiA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 96% identity to pdi:BDI_2695)

MetaCyc: 50% identical to triosephosphate isomerase subunit (Lactobacillus delbrueckii bulgaricus)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• glycolysis III (from glucose) (11/11 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (17/26 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• glycerol degradation to butanol (8/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (13/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Protein Sequence (252 amino acids)

>HMPREF1078_RS12745 triose-phosphate isomerase (Parabacteroides merdae CL09T00C40)
MRKNIVAGNWKMNTTLPEGLALAKGLDEALKGKTPNCDVIIGTPFTHLASVAAAIDTNKI
GVAAENCADKEKGAYTGEVSAAMVASTGAKYVILGHSERRAYYHETPEILKTKVELALAN
GLTPIFCIGEVLEEREAGKHFEVVDAQIKGSLFDLSAEDFAKIVLAYEPVWAIGTGKTAT
SDQAEEIHAHIRATLAAKYGQEIADNCTILYGGSCNASNAKELFAKPNVDGGLIGGASLA
VDKFMPIIEAFN