Protein Info for HMPREF1078_RS12745 in Parabacteroides merdae CL09T00C40

Annotation: triose-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00121: TIM" amino acids 5 to 250 (246 residues), 315 bits, see alignment E=1.8e-98 TIGR00419: triose-phosphate isomerase" amino acids 5 to 240 (236 residues), 200 bits, see alignment E=2.3e-63

Best Hits

Swiss-Prot: 96% identical to TPIS_PARD8: Triosephosphate isomerase (tpiA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 96% identity to pdi:BDI_2695)

MetaCyc: 50% identical to triosephosphate isomerase subunit (Lactobacillus delbrueckii bulgaricus)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>HMPREF1078_RS12745 triose-phosphate isomerase (Parabacteroides merdae CL09T00C40)
MRKNIVAGNWKMNTTLPEGLALAKGLDEALKGKTPNCDVIIGTPFTHLASVAAAIDTNKI
GVAAENCADKEKGAYTGEVSAAMVASTGAKYVILGHSERRAYYHETPEILKTKVELALAN
GLTPIFCIGEVLEEREAGKHFEVVDAQIKGSLFDLSAEDFAKIVLAYEPVWAIGTGKTAT
SDQAEEIHAHIRATLAAKYGQEIADNCTILYGGSCNASNAKELFAKPNVDGGLIGGASLA
VDKFMPIIEAFN