Protein Info for HMPREF1078_RS12515 in Parabacteroides merdae CL09T00C40

Annotation: F0F1 ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 6 to 176 (171 residues), 90.5 bits, E=7.8e-30
• PF00213: OSCP
  • amino acids 6 to 176 (171 residues), 124.2 bits, E=3.1e-40

Best Hits

Swiss-Prot: 78% identical to ATPD_PARD8: ATP synthase subunit delta (atpH) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 78% identity to pdi:BDI_0265)

MetaCyc: 32% identical to ATP synthase F1, delta subunit (Synechococcus elongatus PCC 7942 = FACHB-805)
ATPSYN-RXN [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

• ATP biosynthesis (1/1 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Protein Sequence (180 amino acids)

>HMPREF1078_RS12515 F0F1 ATP synthase subunit delta (Parabacteroides merdae CL09T00C40)
MDIGTISSRYAKALFSLAKEKGLETRVYDDMKMLADSFSLEPGLRVALGNPILPAEEKLK
LLTAAGGIEVSDLYERFMHLVLEHKRESLLLFMAHIYIHLYRKDKRITRVQFSTAVPVSE
EVKVHLQNKLKEETGSTIEFSGIVQPELIGGFRLRIGNYRIDASYATQLRDIRSRLLENR