Protein Info for HMPREF1078_RS12510 in Parabacteroides merdae CL09T00C40

Annotation: F0F1 ATP synthase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00430: ATP-synt_B
  • amino acids 11 to 140 (130 residues), 77.2 bits, E=6.3e-26
• TIGR01144: ATP synthase F0, B subunit
  • amino acids 15 to 161 (147 residues), 92.3 bits, E=1.4e-30

Best Hits

Swiss-Prot: 87% identical to ATPF_PARD8: ATP synthase subunit b (atpF) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 87% identity to pdi:BDI_0266)

Predicted SEED Role

"ATP synthase F0 sector subunit b"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (166 amino acids)

>HMPREF1078_RS12510 F0F1 ATP synthase subunit B (Parabacteroides merdae CL09T00C40)
MSLLTPDSGLLFWMIVSFGIVFVILSKYGFPVIIKAVEQRKAYIDNSLETARQANEQLAN
IQAEGARILAEAKEKQNAILKEAFAEKEQIIDEAHRKAAAETRLQVEEAARRIREEKEKA
IREVRSEIADLSIAIAEKVMKEKISRDKEQQQIIDRLLDEVSFCKS