Protein Info for HMPREF1078_RS12115 in Parabacteroides merdae CL09T00C40

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF00085: Thioredoxin" amino acids 3 to 101 (99 residues), 112.1 bits, see alignment E=2.9e-36 TIGR01068: thioredoxin" amino acids 6 to 102 (97 residues), 124.3 bits, see alignment E=9.7e-41 PF13098: Thioredoxin_2" amino acids 16 to 97 (82 residues), 32.7 bits, see alignment E=2e-11 PF14595: Thioredoxin_9" amino acids 20 to 81 (62 residues), 26 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 50% identical to THIO1_NOSSO: Thioredoxin 1 (trxA) from Nostoc sp. (strain ATCC 29151 / PCC 7119)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 88% identity to pdi:BDI_3483)

MetaCyc: 42% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>HMPREF1078_RS12115 thioredoxin (Parabacteroides merdae CL09T00C40)
MALQITDANFEELVNSGKPMVLDFWAEWCGPCRMVGPIIDELATEYEGRVTIGKMDVDNN
NDVVAQFGIRNIPTVLFFKDGKVVDKQVGAAPKTTFVSKIEALL