Protein Info for HMPREF1078_RS11925 in Parabacteroides merdae CL09T00C40

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 8 to 174 (167 residues), 178 bits, see alignment E=1.7e-56 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 9 to 173 (165 residues), 95 bits, see alignment E=3.9e-31 PF04542: Sigma70_r2" amino acids 13 to 76 (64 residues), 34.4 bits, see alignment E=2.4e-12 PF08281: Sigma70_r4_2" amino acids 119 to 170 (52 residues), 60.6 bits, see alignment E=1.4e-20 PF04545: Sigma70_r4" amino acids 124 to 170 (47 residues), 37 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: None (inferred from 68% identity to bhl:Bache_2470)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>HMPREF1078_RS11925 RNA polymerase sigma-70 factor (Parabacteroides merdae CL09T00C40)
MEYSADLKAFNQLFADYQGRFIRFANIYVRDIAVAEDFTIEALMQYWENRNTLKADSNVP
AYILTIIKNKCINYLQHIQVREDASEHLKNHAEWELNTRISTLEACNPEELFTAEAQEIV
NKTLATLPEQTRRIFIMSRYENKPYKEIAETLGMTTKGVEYHISQALKKLHVNLKDYIPL
LVFLSYMN