Protein Info for HMPREF1078_RS11845 in Parabacteroides merdae CL09T00C40

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 48% identical to CSD_BACHD: Probable cysteine desulfurase (csd) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 90% identity to pdi:BDI_3543)

MetaCyc: 50% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
superpathway of L-alanine biosynthesis (2/4 steps found)
superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
thiazole component of thiamine diphosphate biosynthesis II (3/7 steps found)
thiazole component of thiamine diphosphate biosynthesis I (2/6 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
molybdopterin biosynthesis (1/6 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>HMPREF1078_RS11845 cysteine desulfurase (Parabacteroides merdae CL09T00C40)
MLDVQSIRKDFPILDHKIYDKPLIYFDNGATTQKPRCVVEKIESGYYNVNANIHRGVHFL
SQAATEAHEDARKTVQQFLNARSSNEIIFTRGTTEAINLIASSFTDECMSAGDEVIVSVM
EHHSNIVPWQIQAARKGITLKVIPMNEKGELCMDTFRSLFSERTKLVSVTHVSNVLGTIN
PVKEIIEEAHNHEVPVLIDGAQAVPHLKVDVQDLDAEFYVFSGHKIYGPTGIGVLYGKEE
WLDKLPPYQGGGEMIASVSFEKTTFNELPFKFEAGTPDYIGSTALAEALRYVGRLGMDNI
AAYEDELLRYATDKLNAIDGMRIFGQAAHKGAVLSFLVGNIHHYDMGMLLDRLGIAVRTG
HHCAQPLMQDLGIEGTVRASFSFYNTKEEIDAFAAGIERVRKMF