Protein Info for HMPREF1078_RS11620 in Parabacteroides merdae CL09T00C40

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details PF01694: Rhomboid" amino acids 66 to 210 (145 residues), 75.2 bits, see alignment E=6.1e-25 PF20216: DUF6576" amino acids 249 to 292 (44 residues), 41.2 bits, see alignment 1.5e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to pdi:BDI_3604)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>HMPREF1078_RS11620 rhomboid family intramembrane serine protease (Parabacteroides merdae CL09T00C40)
MGDIFTNLKRTFNSGNILAKLIYINVGLFVIIRLASVILMLFNLGGFPFLQYLQVPSSPE
LLLYRPWTIITYMFTHFDFLHILFNMLWLYWFGGLFLTFFSERQLGGLYLLGGIAGAVLF
LVAYNIFPYFRTVAAYSYLMGASASVMAIVFAVSFYRKDLEIGLFLIGRIKLIYLALFTF
VIDLLAITSTNAGGHIAHIGGALFGIWFAARIKEGKDLTAPMNRLLDWVVNLGKRKPKMR
VTYKRPETDYEYNARKHRETVDLDAILDKLKRSGYESLSAEEKKKLFDASKK