Protein Info for HMPREF1078_RS11570 in Parabacteroides merdae CL09T00C40

Annotation: Mrp/NBP35 family ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF01883: FeS_assembly_P" amino acids 8 to 71 (64 residues), 43.8 bits, see alignment E=8.3e-15 PF10609: ParA" amino acids 98 to 347 (250 residues), 310.7 bits, see alignment E=2.4e-96 PF13614: AAA_31" amino acids 101 to 248 (148 residues), 43 bits, see alignment E=1.8e-14 PF09140: MipZ" amino acids 102 to 149 (48 residues), 29.5 bits, see alignment 1.7e-10 PF01656: CbiA" amino acids 103 to 327 (225 residues), 48.9 bits, see alignment E=2.2e-16 PF02374: ArsA_ATPase" amino acids 106 to 138 (33 residues), 25.7 bits, see alignment 2.3e-09

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 88% identity to pdi:BDI_3650)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>HMPREF1078_RS11570 Mrp/NBP35 family ATP-binding protein (Parabacteroides merdae CL09T00C40)
MTLYPKLIMDALAKVRYPGTGKDLVTMGMVEDNIRIDGNKVSFSLLFEKPNDPFIKSVVK
AAETAILTYVGEEVDIKGNITVDAKQAARPEPDKLLPEVKNIIAVSSGKGGVGKSTVAAN
LAVALALQGHKVGLLDADIFGPSQPKMFNVEEARPYMVEVGGRELIEPAANYGVKLLSIG
FFVNKEDAVLWRGAMASNALKQLIGDANWGDLDYFLIDLPPGTSDIHLTMVQTLAITGAI
VVSTPQEVALADARKGISMFTGEKINVPVLGLVENMSWFTPAELPENKYYLFGKEGGKRL
AEELNIPLLGQIPIVQSICEGGDSGKPVALNPDSITGQAFQKLAENVVKQIDYRNEHLDP
TKRVVVTKK