Protein Info for HMPREF1078_RS11430 in Parabacteroides merdae CL09T00C40

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details PF01032: FecCD" amino acids 15 to 335 (321 residues), 249.6 bits, see alignment E=2e-78

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 83% identity to pdi:BDI_3674)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>HMPREF1078_RS11430 iron ABC transporter permease (Parabacteroides merdae CL09T00C40)
MKKQVFIFYPFLLVLLLLLFAGGLVYGAVSIPVESVVNILLGEGTERLAWQNIVLQSRFP
QAVTALLAGASLAVSGLLLQTLFRNPLAGPSILGISDGANLGVAAIMLYFGGSLSMVTDL
PISGYLAVIMAAFSGAACILGLIIYFSAKVKNNVMLLIIGIMIGYLASSLISVLNYYAST
DKVHAFVMWGLGNFSGVSLQQLPYFAGFTCIGLLLAILLIKPLNALLLGEMYAANLGIKI
RRTRILILLCTGLLTATTTAFCGPISFIGLAVPHVARLMLGSSNHKMLVPVTLLTGSCIA
LLCNLLMVLPGTHNILPLNAVTPMLGAPVIIYVIVNRKNIQYFD