Protein Info for HMPREF1078_RS11315 in Parabacteroides merdae CL09T00C40

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 12 to 393 (382 residues), 333.6 bits, E=1.1e-103
• PF00206: Lyase_1
  • amino acids 24 to 303 (280 residues), 173.5 bits, E=3.7e-55

Best Hits

Swiss-Prot: 89% identical to ARLY_PARD8: Argininosuccinate lyase (argH) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 89% identity to pdi:BDI_3689)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of arginine and polyamine biosynthesis (10/17 steps found)
• L-arginine biosynthesis IV (archaea) (3/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (445 amino acids)

>HMPREF1078_RS11315 argininosuccinate lyase (Parabacteroides merdae CL09T00C40)
MAQKLWEKNVQVDQEVDTFTVGKDREMDLYLAKYDVLGSMAHITMLESIGLLTKEELTIL
LAELKNIYAVADCGRFVIEEGVEDVHSQVELMLTRSLGDTGKKIHSGRSRNDQVLLDLKL
FTRAQIQEIVELVSDLFEVLISQSNRYKDVLLPGYTHLQIAMPSSFGLWFGAYAESLTDD
LQMMQAAYKVCNRNPLGSAAGYGSSFPLRRQMTTDLLGFDSLDYNVVYAQMGRGKMERTV
AFAMAGIAATLSKLAFDACMFNSQNFGFIKLPDQFTTGSSIMPHKKNPDVFELTRAKCNK
LQGLPQQITLISNNLPSGYFRDLQIIKEVFLPSFDELKDCLRMVTHMMREVKVNEQILDD
DKYALLFSVEEVNRLVLEGMPFRDAYKQVGLNIEAGKFVPVKKVHHTHEGSIGNLCNDQI
SALMQNIMDGFAFNRVNEAEQQLLS