Protein Info for HMPREF1078_RS11200 in Parabacteroides merdae CL09T00C40

Annotation: aspartate--ammonia ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF03590: AsnA" amino acids 22 to 255 (234 residues), 355.9 bits, see alignment E=5.3e-111 TIGR00669: aspartate--ammonia ligase" amino acids 22 to 337 (316 residues), 412 bits, see alignment E=1e-127

Best Hits

Swiss-Prot: 93% identical to ASNA_PARD8: Aspartate--ammonia ligase (asnA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01914, aspartate--ammonia ligase [EC: 6.3.1.1] (inferred from 93% identity to pdi:BDI_3717)

MetaCyc: 52% identical to asparagine synthetase A (Escherichia coli K-12 substr. MG1655)
Aspartate--ammonia ligase. [EC: 6.3.1.1]

Predicted SEED Role

"Aspartate--ammonia ligase (EC 6.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>HMPREF1078_RS11200 aspartate--ammonia ligase (Parabacteroides merdae CL09T00C40)
MSYLIKPAGYKALLNLSQTEMGIKKIKDFFQQNLSSELRLRRVTAPLFVLKGMGINDDLN
GTERAVTFPIKDLDDAKAEIVHSLAKWKRLTLADYQIEKGYGIYTDMNAIRSDEELGNLH
SLYVDQWDWERVMGAEERNVDFLKEIVRRIYAAMVRTEYLVYEMFPEIRPTLPQQIHFIH
SEDLLQKYPTFTPKEREDAITKEYGAVFIIGIGCKLSNGEKHDGRAPDYDDWSTIAENGQ
VGLNGDLLVWDEVLNRSLELSSMGIRVDKEALLRQLEICNAEEKKELYFHKRLLNNELPL
SIGGGIGQSRLCMFYLRKAHIGEIQASIWPEEMRREARAAGMYLI