Protein Info for HMPREF1078_RS11100 in Parabacteroides merdae CL09T00C40

Annotation: (d)CMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00017: cytidylate kinase
  • amino acids 3 to 215 (213 residues), 235 bits, E=3.9e-74
• PF13189: Cytidylate_kin2
  • amino acids 5 to 186 (182 residues), 30.7 bits, E=7e-11
• PF13238: AAA_18
  • amino acids 6 to 168 (163 residues), 35.5 bits, E=2.8e-12
• PF02224: Cytidylate_kin
  • amino acids 6 to 222 (217 residues), 233.8 bits, E=3.6e-73

Best Hits

Swiss-Prot: 79% identical to KCY_PARD8: Cytidylate kinase (cmk) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 79% identity to pdi:BDI_3739)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• superpathway of pyrimidine nucleobases salvage (3/4 steps found)
• UTP and CTP de novo biosynthesis (2/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• CMP phosphorylation (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (12/18 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (1/4 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (3/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.25

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Protein Sequence (230 amino acids)

>HMPREF1078_RS11100 (d)CMP kinase (Parabacteroides merdae CL09T00C40)
MKKIIIAIDGVSSTGKSTMAKDLARELGYTYIDTGAMYRAVTLYSLQHGFFTSGGIDEQK
LQDAMNDIDISFRFNPETGRPDTYLNGVKVEKEIRGMEVANRVSPIAALGFVRRAMVAKQ
QEMGKAKGIVMDGRDIGTVVFPDAELKIYVTASPEVRAQRRLDELKAKGEVASFEEVLEN
VKTRDHIDMTRVESPLRKADDALELDNSHLTIAEQKAWLLEQYEKVVTSD