Protein Info for HMPREF1078_RS11100 in Parabacteroides merdae CL09T00C40
Annotation: (d)CMP kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to KCY_PARD8: Cytidylate kinase (cmk) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 79% identity to pdi:BDI_3739)Predicted SEED Role
"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
- superpathway of pyrimidine nucleobases salvage (3/4 steps found)
- UTP and CTP de novo biosynthesis (2/3 steps found)
- superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
- CMP phosphorylation (1/2 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (12/18 steps found)
- pyrimidine deoxyribonucleotide phosphorylation (1/4 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (3/9 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.4.25
Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (230 amino acids)
>HMPREF1078_RS11100 (d)CMP kinase (Parabacteroides merdae CL09T00C40) MKKIIIAIDGVSSTGKSTMAKDLARELGYTYIDTGAMYRAVTLYSLQHGFFTSGGIDEQK LQDAMNDIDISFRFNPETGRPDTYLNGVKVEKEIRGMEVANRVSPIAALGFVRRAMVAKQ QEMGKAKGIVMDGRDIGTVVFPDAELKIYVTASPEVRAQRRLDELKAKGEVASFEEVLEN VKTRDHIDMTRVESPLRKADDALELDNSHLTIAEQKAWLLEQYEKVVTSD