Protein Info for HMPREF1078_RS11060 in Parabacteroides merdae CL09T00C40

Annotation: dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00186: DHFR_1
  • amino acids 3 to 163 (161 residues), 189.5 bits, E=1.7e-60

Best Hits

Swiss-Prot: 45% identical to DYR_BACSU: Dihydrofolate reductase (dfrA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 82% identity to pdi:BDI_3748)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate transformations II (plants) (8/11 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.3

Protein Sequence (165 amino acids)

>HMPREF1078_RS11060 dihydrofolate reductase (Parabacteroides merdae CL09T00C40)
MSTISIVAAISDNNAIGKNLGLLWHMPADMKRFKDLTTGHAVIMGRKTFESLPKGGLPNR
KNVVLTTMPEAGFINCFACESMHDALDICEKEENIFIIGGSLVYRQGLGIADKMYLTRIH
GEFPDADAFFPVVNWDLWEEVERQEFPADEKNPYPYTFLTYVRKK