Protein Info for HMPREF1078_RS11055 in Parabacteroides merdae CL09T00C40

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 169 to 188 (20 residues), see Phobius details TIGR03284: thymidylate synthase" amino acids 2 to 84 (83 residues), 134.7 bits, see alignment E=1.9e-43 amino acids 85 to 264 (180 residues), 306.2 bits, see alignment E=1.1e-95 PF00303: Thymidylat_synt" amino acids 2 to 264 (263 residues), 425.2 bits, see alignment E=4.4e-132

Best Hits

Swiss-Prot: 92% identical to TYSY_PARD8: Thymidylate synthase (thyA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 92% identity to pdi:BDI_3749)

MetaCyc: 65% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>HMPREF1078_RS11055 thymidylate synthase (Parabacteroides merdae CL09T00C40)
MKQYLELLDRVLREGVKKEDRTGTGTYSVFGHQMRFNLEDGFPLLTTKKLHLKSIIYELL
WFLQGDTNAKYLQEHGVRIWNEWADPDGNLGHIYGFQWRSWPDYKGGNIDQISEAVETIK
HNPDSRRIIVSAWNVADLDNMNLPPCHAFFQFYVANGRLSLQMYQRSADIFLGVPFNIAS
YALLLQMMAQVTGLKAGDFVHTLGDAHIYTNHLEQVKLQLTRDPRPLPRMEINPDVKDIF
GFQYEDFNLTGYDPHPHIKGEVAV