Protein Info for HMPREF1078_RS10965 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 248 (228 residues), 100.1 bits, see alignment E=2.2e-32 PF02687: FtsX" amino acids 289 to 411 (123 residues), 64.8 bits, see alignment E=8.1e-22

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 52% identity to ppn:Palpr_0088)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>HMPREF1078_RS10965 ABC transporter permease (Parabacteroides merdae CL09T00C40)
MFDIDRWVEIWVTITRNKTRSLLTGFGVFWGILMLVILLGSGNGFKNGVLKNVDGFSTNS
AFFFSERTGEPYKGYKKGRYWQMRNRDLETIRQRVKGVRYLSPMIMQWGGQNNVVRGQKA
GTYNVRGVYSEYFNIETQHILAGRLLNEIDMIEKRKVCLIGNIVREVLFAPDEDPIGQYI
RVNGIYYQVVGVIKPKPRAQIGGRTEESVMIPFKTLQQASNQGDKFWFLCATADDGYSCD
KMVEDIKTVLRSQNEISPTDEHAISSFTIAKQFETFDMLFTGINILVWLVGIGTLLAGII
GVSNIMMVTVRERTREIGVRRAIGAKPFDIISQIMSESLLLTSLAGLIGLSVGVFLLDVV
NNAMASDGDVSNDTFFSNPEIHIGTAVAATVILLFSGLLAGLIPAWRAMQIKAIDAIREE