Protein Info for HMPREF1078_RS10660 in Parabacteroides merdae CL09T00C40

Annotation: acetylornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF02729: OTCace_N" amino acids 2 to 160 (159 residues), 92.7 bits, see alignment E=2.5e-30 PF00185: OTCace" amino acids 184 to 311 (128 residues), 70.3 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 84% identical to AOTC_BACTN: N-acetylornithine carbamoyltransferase (argF') from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K13043, N-succinyl-L-ornithine transcarbamylase [EC: 2.1.3.11] (inferred from 92% identity to pdi:BDI_2259)

MetaCyc: 84% identical to N-succinylornithine carbamoyltransferase (Bacteroides thetaiotaomicron)
N-succinylornithine carbamoyltransferase. [EC: 2.1.3.11]

Predicted SEED Role

"N-acetylornithine carbamoyltransferase (EC 2.1.3.9)" in subsystem Arginine Biosynthesis extended (EC 2.1.3.9)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.11 or 2.1.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>HMPREF1078_RS10660 acetylornithine carbamoyltransferase (Parabacteroides merdae CL09T00C40)
MRNFTCVQDLGNLKQALAEAFEIKKDRYQFTGLGKNKTLLMIFFNSSLRTRLSTQKAAMN
LGMNTMVLDVNQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDVIGIRSFARFESKED
DYNEKILNQFIQYSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPKAL
PQAVPNSFAEWMNATDYEFVITHPEGYELDPRFVGNARVEYDQKKAFEGADFIYAKNWAA
YADPNYGKVLNTDRSWTVDTEKMALTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAA
NREISAQTVLKKILTSLLPGD