Protein Info for HMPREF1078_RS10650 in Parabacteroides merdae CL09T00C40

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 19 to 248 (230 residues), 140.1 bits, E=9.9e-45
• TIGR01027: glutamate 5-kinase
  • amino acids 20 to 362 (343 residues), 322.4 bits, E=2e-100
• PF01472: PUA
  • amino acids 293 to 360 (68 residues), 50.3 bits, E=1.8e-17

Best Hits

Swiss-Prot: 74% identical to PROB_BACTN: Glutamate 5-kinase (proB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 90% identity to pdi:BDI_2256)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Protein Sequence (374 amino acids)

>HMPREF1078_RS10650 glutamate 5-kinase (Parabacteroides merdae CL09T00C40)
MKRNTQNNGQLPIIDWQFNRIAVKIGSNVLTRKDGTLDITRMSALVDQVAKLHRKGVEVV
LISSGAVASGRSEIKASKKLDPVSARQLYSAVGQAKLINRYYELFREHGMTCGQVLTTKE
NFGSRTHYLNQKHCMEVMLENKVIPIVNENDTISVTELMFTDNDELSGLIATMMGMDALI
ILSNIDGIYNGNPSDPSSTVIREIDGSKEDLSEYVQTSKSSFGRGGMLTKCSIAQKVADE
GITVIIANGKKDNILVDLLAKDSRTVCTRFIPSNKPVSSVKKWIAHSEGFAKGEIHINRG
AEEALLGPKATSILLVGVTRIIGDFEKDDIVKVINEEGVQLGVGCAGYDSTEARELIGSR
DKKPLVHYDYLYLD