Protein Info for HMPREF1078_RS10645 in Parabacteroides merdae CL09T00C40

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 37 to 409 (373 residues), 223.7 bits, E=3.5e-70
• PF13193: AMP-binding_C
  • amino acids 459 to 539 (81 residues), 86.9 bits, E=1.4e-28

Best Hits

KEGG orthology group: K01895, acetyl-CoA synthetase [EC: 6.2.1.1] (inferred from 96% identity to pdi:BDI_2255)

Predicted SEED Role

"Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases"

MetaCyc Pathways

• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• ethanol degradation II (1/3 steps found)
• ethanol degradation III (1/3 steps found)
• ethanol degradation IV (1/3 steps found)
• chitin deacetylation (1/4 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (1/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.1

Protein Sequence (556 amino acids)

>HMPREF1078_RS10645 AMP-binding protein (Parabacteroides merdae CL09T00C40)
MLERFINKTTFESQEDFIKNFKIKVPENFNFGYDVVDAWAEEEPDKIALCWTNDQGEHID
FTFADLKKYTDQTAAYFQSLGIGHGDMVMLILKRRYEFWFSIIALHKLGAVVIPATHLLT
KKDIVYRANAADIKMIVCAGEEVITQHIIDSLPDSPSIKSVVSVGPEIPEGFEDFHKGLE
NAAPFVRPEHPNSNDDISLMYFTSGTTGNPKMVAHDFTYPLGHIVTGSFWHNLHKDSLHL
TIADTGWGKAVWGKLYGQWIAGATVFVYDHEKFTPADMLQMIQDYRITSLCAPPTIFRFL
IREDLTKYDLSSLQYCTIAGEALNPAVFDTFYKLTGIKLMEGFGQTETTLTVATFPWMEP
KPGSMGVPNPQYDVDLLRPDGTRAEDGEQGQIVIHTTNGKPIGLFKEYYRDAERTREAWH
DGLYYTGDVAWRDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKDYKDKAGDALVKELQDHVKKVTAPYKYPRVVEFVDELPKTISGKI
RRVEIRATDNEKKHTK