Protein Info for HMPREF1078_RS10580 in Parabacteroides merdae CL09T00C40

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 2 to 319 (318 residues), 304.1 bits, E=6.9e-95
• PF01118: Semialdhyde_dh
  • amino acids 3 to 123 (121 residues), 99 bits, E=2.6e-32
• PF02774: Semialdhyde_dhC
  • amino acids 143 to 293 (151 residues), 40 bits, E=4.9e-14

Best Hits

Swiss-Prot: 91% identical to ARGC_PARD8: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 91% identity to pdi:BDI_0068)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• superpathway of arginine and polyamine biosynthesis (10/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Protein Sequence (322 amino acids)

>HMPREF1078_RS10580 N-acetyl-gamma-glutamyl-phosphate reductase (Parabacteroides merdae CL09T00C40)
MIKVGIIGGAGYTAGELIRLLLNHPDAEITFVNSTSNAGNKITDVHSGLYGETDLIFTDE
LPLDQIDLLFFCTAHGDTKKFMESHTVPENVKIIDLSMDYRIESPEHDFVYGLPELNRRR
ICNAQHIANPGCFATCIQLAVLPLAKHLMLNSDLHVNAITGSTGAGVKPSSTSHFSWRND
NISIYKPFTHQHLAEIGQSLRQLQNSFNSMVNFIPVRGNFSRGIFATTYLDCKIGLDEIK
RIYEEYYADHSFTFITDKNPDLKQVVNTNKCLIYLLKQEDKLLIVSMIDNLLKGASGQAV
HNMNLLFGLEETVGLHLKPSAF