Protein Info for HMPREF1078_RS10470 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 14 to 204 (191 residues), 44.9 bits, E=2e-15
• PF00534: Glycos_transf_1
  • amino acids 227 to 370 (144 residues), 98.9 bits, E=3.7e-32
• PF13692: Glyco_trans_1_4
  • amino acids 234 to 365 (132 residues), 78.6 bits, E=8.7e-26

Predicted SEED Role

"Putative glycosyltransferase protein"

Protein Sequence (408 amino acids)

>HMPREF1078_RS10470 glycosyltransferase (Parabacteroides merdae CL09T00C40)
MKILQLNKYFYQKGGAETVFFNTISTLENRGHQVIPFALKNKKNKFSEYESYFVDYPELS
ESNIWTKITNIPAFIYNRQAAKQLERLILDKKPDIAHIHLLFNSLSVSILPVLQKYRIPT
VMTVHDYRLICPAYTLTNGKGKICELCKDRHFIHCTLNRCSNGNLTNSMLLSLENSFRSC
FYEPLNYIDKFIFVSKFAQKKHIEFNPGYASKAVQLYNFTPDIPTRINKKINHRYLLYFG
RLSNEKGINSLLEAIRDIPEIDLKIIGRGPLSKEIGNNYPKNVSFLGFKEGQELKEYVKN
ALFTIVPSEWYENNPLSIIESLSLGTPVIGSNIGGIPELIQDEKTGFTFTMGSPADLTKT
IRKAIAIPEEKLYEMSIACNKFAQQHFSADKHFNYLISIYQSILKASK