Protein Info for HMPREF1078_RS10265 in Parabacteroides merdae CL09T00C40

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03740: PdxJ
  • amino acids 3 to 235 (233 residues), 311.7 bits, E=1.2e-97
• TIGR00559: pyridoxine 5'-phosphate synthase
  • amino acids 4 to 236 (233 residues), 285.1 bits, E=2.3e-89

Best Hits

Swiss-Prot: 85% identical to PDXJ_PARD8: Pyridoxine 5'-phosphate synthase (pdxJ) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 85% identity to pdi:BDI_1545)

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Protein Sequence (238 amino acids)

>HMPREF1078_RS10265 pyridoxine 5'-phosphate synthase (Parabacteroides merdae CL09T00C40)
MTNLSVNINKVATIRNARGGNVPNVLKVALDCETFGAQGITVHPRPDERHIRYSDVYALK
PEIKTEFNIEGYPCEKFIDLVLKVKPTQVTLVPDAPDAITSNAGWDVKAHFDQLSELVET
FTSHGIRTSIFVGTDLENIELAAKTGTDRIELYTEPYATLYPVNREEAIAPFISAAGLAK
NLGLGINAGHDLSLENLAYFHQNIPGLDEVSIGHALISDALYYGLKETIRLYKECLVY