Protein Info for HMPREF1078_RS10210 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 333 to 347 (15 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 23 to 378 (356 residues), 171.1 bits, see alignment E=3.8e-54 PF01061: ABC2_membrane" amino acids 187 to 346 (160 residues), 35.1 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 71% identity to pdi:BDI_1532)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>HMPREF1078_RS10210 ABC transporter permease (Parabacteroides merdae CL09T00C40)
MNMKVISVIHDEFKTIAGSYAILLVLMGGIFVYGLLYNYMYAPDLVRKVPVAVVDHSHSE
LSRHYVRLLDATPQVNVVTTATGYPEAQDMMKSGRVAGILYLPDDFEDRVARGEESVFIM
YETTSAFLYYLAMQEASAASMLALNDDYRPEMLVFLPKEATTKLASAQAVEVVGTALYNP
TEGYGTYLIPSVLVVIIFQTLMMVIAMISGDERHSGLIVRFAGNPVNLSLERMAQVVIGK
TFVYGMLYAVFALFLLGLIPLMFGLPDIGNPLYVIMLMIPFLLATSFFGLTASLFFTDSD
APLLMIAFFSVGLIFLSGVSYPMELMPWYWKLVHYLIPAAPATMAYVKLNSMGASMSEIQ
PEYIILWVQCIFYFVTACLVYRYNIRKAVAKGTSLVITDDFSSHKS