Protein Info for HMPREF1078_RS10120 in Parabacteroides merdae CL09T00C40

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 189 (184 residues), 196.5 bits, E=2.7e-62
• PF00117: GATase
  • amino acids 7 to 184 (178 residues), 130.3 bits, E=2.1e-41
• PF07722: Peptidase_C26
  • amino acids 69 to 169 (101 residues), 32 bits, E=3.3e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 198 to 506 (309 residues), 475.4 bits, E=7.9e-147
• PF02540: NAD_synthase
  • amino acids 207 to 277 (71 residues), 28.7 bits, E=2.2e-10
• PF00764: Arginosuc_synth
  • amino acids 214 to 282 (69 residues), 27.6 bits, E=8.7e-10
• PF03054: tRNA_Me_trans
  • amino acids 214 to 246 (33 residues), 23.4 bits, see alignment (E = 1.3e-08)
• PF00958: GMP_synt_C
  • amino acids 416 to 505 (90 residues), 146.5 bits, E=5.8e-47

Best Hits

Swiss-Prot: 96% identical to GUAA_PARD8: GMP synthase [glutamine-hydrolyzing] (guaA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 96% identity to pdi:BDI_1829)

MetaCyc: 52% identical to GMP synthase monomer (Saccharomyces cerevisiae)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (506 amino acids)

>HMPREF1078_RS10120 glutamine-hydrolyzing GMP synthase (Parabacteroides merdae CL09T00C40)
MHEKLIILDFGSQTTQLIGRRVRELNMYCEIVPYNKFPHDATGVKGVILSGSPYSVYDAN
AFKADLSEIRGKYPVLGICYGAQFLAYTSGGNVEPADSREYGRANLSYIDNTDELLKGIN
VGSQIWMSHGDTITVLPENFKVIASTDDVKAAAYHVEGEQTWGVQFHPEVFHSTDGTKLL
NNFLNICGCAKDWTPASFIESTVAELKEQLGDDKVILALSGGVDSSVTAVLLHKAIGKNL
TCIFVDHGLLRKNEFENVLKDYEHLGLNVIGVDAKEKFYKELAGVSEPEKKRKIIGKGFI
DVFDEEAHKLKDIKWLGQGTIYPDVIESLSITGTVIKSHHNVGGLPAKMNLKLVEPLRLL
FKDEVRRVGMELGMQPHLIKRHPFPGPGLGIRILGDITPEKVRILQEADDIYMSLMREWG
LYDKIWQAGVILLPIQSVGVMGDERTYENTVALRAVTSTDAMTADWAQLPYEFLAKVSNE
IINKVKGVNRVVYDISSKPPATIEWE