Protein Info for HMPREF1078_RS10065 in Parabacteroides merdae CL09T00C40

Annotation: lysine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 TIGR00499: lysine--tRNA ligase" amino acids 7 to 502 (496 residues), 617.7 bits, see alignment E=7.5e-190 PF01336: tRNA_anti-codon" amino acids 55 to 138 (84 residues), 58.4 bits, see alignment E=1.1e-19 PF00152: tRNA-synt_2" amino acids 162 to 498 (337 residues), 309 bits, see alignment E=6.5e-96 PF14229: DUF4332" amino acids 509 to 575 (67 residues), 25.9 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 92% identical to SYK_PARD8: Lysine--tRNA ligase (lysS) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 92% identity to pdi:BDI_0150)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>HMPREF1078_RS10065 lysine--tRNA ligase (Parabacteroides merdae CL09T00C40)
MNLLELSEQEIIRRNSMEQLRQMGIEPYPAAEYVTNAFSKEIKENFKDDAEPRPVSIAGR
IMSRRIMGKASFMELQDSEGRIQVYISRDDICPEENKDLYNIVFKKLLDIGDFVGIKGFV
FRTQMGEISVHAQEITVLSKSLKPLPVVKYKDGVAYDGFNDPELRYRQRYVDLVVNDGVK
DIFMKRAAVIKTMRTALDEAGYTEVETPILQSIPGGASARPFITHHNSLDIDLYLRIATE
LYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNWMMSFTEQLLERI
CIAVNGTCESVVDGKTINFKAPYRRLPILDAIKEKTGYDLNGKSEDEIRTICKDLNLEID
ETMGKGKLIDEIFGEFCEGTFIQPTFIIDYPVEMSPLTKMHRSKPGLTERFELMINGKEV
ANAYSELNDPIDQEERFKEQLRLSEKGDDEAMFIDQDFLRALQFGMPPTSGIGIGIDRLV
MLMTGQTTIQEVLLFPQMRPEKTVKKDTADKYVALGIDEAWVPALHKAGYLTTDTLVDAN
PNKLRQELCEMNKKYKLELQNPTAEEVEAWIAGAAK