Protein Info for HMPREF1078_RS10020 in Parabacteroides merdae CL09T00C40

Annotation: OadG family transporter subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 189 to 212 (24 residues), see Phobius details PF00932: LTD" amino acids 28 to 137 (110 residues), 40.5 bits, see alignment E=3.3e-14 PF04277: OAD_gamma" amino acids 190 to 257 (68 residues), 43.3 bits, see alignment E=4.8e-15

Best Hits

KEGG orthology group: None (inferred from 83% identity to pdi:BDI_0162)

Predicted SEED Role

"Membrane protein associated with methylmalonyl-CoA decarboxylase" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>HMPREF1078_RS10020 OadG family transporter subunit (Parabacteroides merdae CL09T00C40)
MINKKIGVLLLFALLVSFGAKAQRATSMRINEVLVINEDNFVDDYGKRHAWIELFNNSAG
SVNIAGCYLTNDKSNPKKYPIPKGDVLTVIPPRQHTLFWADGEPDRGTFHVNFTLDPSKE
NYIALYDADGKTLIDEIVIPASQKADVSYGRTLDGQGEWTALTKVTPSTNNVTLDSNEKI
ENFKENDSWGIGMTLTAMAVVFSGLFLLFIIFKQIGKLSIAASKRNAQKAAGAAVIADNA
GQESGEIFAAIGAALYEMSDDNHDIEHTVLTIRKVQRSYSPWSSKIYGLREVPKK