Protein Info for HMPREF1078_RS09710 in Parabacteroides merdae CL09T00C40

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 6 to 183 (178 residues), 36 bits, E=1e-12
• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 7 to 429 (423 residues), 358.4 bits, E=2.9e-111
• PF01656: CbiA
  • amino acids 9 to 189 (181 residues), 59.1 bits, E=6.6e-20
• PF07685: GATase_3
  • amino acids 248 to 428 (181 residues), 128.5 bits, E=3.8e-41

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (10/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (22/36 steps found)

Protein Sequence (445 amino acids)

>HMPREF1078_RS09710 cobyrinate a,c-diamide synthase (Parabacteroides merdae CL09T00C40)
MCQSHLLIGAASSGSGKTTFTLGLLRALKNRSFKVQPFKCGPDYIDTRHHRMAAGNPSVN
LDLFMMSEAHVRDLYAGYTEKADVAVTEGMMGLFDGYDGMKGSCAEIACMLKIPVVLIVN
AKSTAYSVAPLLYGFKQFNKQVQIVGAVFNFVASENHYSFLKQACEDAGVEALGYLPKCA
DVEIPSRHLGLSLDEDFCFEEFADRVAELVEKHVNINRLLELTKPVATAVVPISAGRHIY
KREPSFPIAVACDPAFNFVYEANIRYLHHLGEVTYFSPLADTSLPDAGFVYLPGGYPELY
LAALSANRQMLQSIRRYVESGGKLLAECGGMMYLCDEIRDKNGYVYPMAGVLHQSATMEN
MKLRLGYRTLLYNETRLKGHEFHYSRLVEQQNPLPSCAVAYTAKGVETDTPLYHYKNVWA
GYTHLYWADPVGNEWFTKFVIDGNI