Protein Info for HMPREF1078_RS09620 in Parabacteroides merdae CL09T00C40

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 30 to 55 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details amino acids 128 to 128 (1 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details amino acids 492 to 511 (20 residues), see Phobius details amino acids 523 to 541 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 28 to 457 (430 residues), 183.4 bits, see alignment E=1.1e-57 PF00324: AA_permease" amino acids 36 to 451 (416 residues), 108.3 bits, see alignment E=6.1e-35 PF13906: AA_permease_C" amino acids 429 to 479 (51 residues), 60.4 bits, see alignment 2.2e-20

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 89% identity to bfr:BF0679)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>HMPREF1078_RS09620 amino acid permease (Parabacteroides merdae CL09T00C40)
MGLFIKKPLEALQAEANQTGSKSLKRVLGPWSLVALGVGVIIGAGLFSITGTVAAGYTGP
AITLSFAIAAIGCCFAGLCYAEFASMIPVAGSAYTYSYATMGELIAWIIGWDLVLEYTVA
ATTVSISWSRYLVVFLEGLGINLPTAFTACPWDGGIVNIPAFLIVVLMSLFLIRGTEGSS
IFNGIIVFLKVSVVLIFVFLGWKYINTDNYVPYIPANTGTLGEYGLSGVLRGAAIVFFAF
LGFDAVSTAAQEAKNPKRDMPIGILVSLLVCTILYMLFAHVMTGVAHYSEFGGQQGIAPV
AIAIEHMGEVDASGVLHPDYPWMNKAIVLAILFGYCSVIMVTLLGQSRVFLSMSHDGLLP
PFFSHINEKFRTPARSNLLFMVLVGLLAAFVPARLAGEMTSIGTLFAFTLVCAGVLVVRK
TMPDVHRAFKTPLVPFVPVAGIITCLCMMLFLPADTWIRLVLWMLIGLDIYACYGIKHSK
LEYNQANRHGQLALNMIGIVLAILCVITGLWHQQTVGWEESKVLLIISFVFAFTHLGFYM
VRIWKQTTKVF