Protein Info for HMPREF1078_RS09440 in Parabacteroides merdae CL09T00C40

Annotation: DUF418 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details PF04235: DUF418" amino acids 228 to 388 (161 residues), 151.2 bits, see alignment E=2.6e-48

Best Hits

KEGG orthology group: None (inferred from 81% identity to bth:BT_1547)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>HMPREF1078_RS09440 DUF418 domain-containing protein (Parabacteroides merdae CL09T00C40)
MELSASKIPRIEVVDALRGFAVMAIILVHNLEHFIFPVYPTEQPAWLAVLNDGVFNVIFS
LFAGKAYAIFALLFGFTFYIQCHNQTKKGKDFGYRFLWRLVLLLGFATLNAAFFPAGDVL
LLFAVVGLVLFLVRKWSDKAILITAIILLIQPIEWYHYIMSLLNPAHALPDLGVGAMYSE
VAEYTKAGNFLDFIWGNITLGQKASLYWAIGAGRFLQTAGLFLVGLYIGRKELFVTSETH
LRFWVKVLIIAAICFAPLYSLKEQIMASDNALIKQTVGTAFDMWQKFAFTFILVSSFVLL
YQKECFRKAVSALRFYGKMSLTNYIAQSIMGAIIYFPFGLYLAPYCGYTISLLIGFALFL
LQVSFCKWWLASHKQGPLESIWHKWTWMFSNNK