Protein Info for HMPREF1078_RS08635 in Parabacteroides merdae CL09T00C40

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 6 to 476 (471 residues), 602.4 bits, E=3.2e-185
• PF00479: G6PD_N
  • amino acids 10 to 195 (186 residues), 206.8 bits, E=4.6e-65
• PF02781: G6PD_C
  • amino acids 197 to 476 (280 residues), 377.1 bits, E=5.4e-117

Best Hits

Swiss-Prot: 51% identical to G6PD_AGGAC: Glucose-6-phosphate 1-dehydrogenase (zwf) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 79% identity to pdi:BDI_0647)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• heterolactic fermentation (13/18 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (489 amino acids)

>HMPREF1078_RS08635 glucose-6-phosphate dehydrogenase (Parabacteroides merdae CL09T00C40)
MKTASNQLLVIFGASGDLTGRKLLPSLYELHVRGLLPERFCILGAARTEYTDDEYRAFEK
VHIRESLKNKEVDDVELDSFLRRVFYLAFDSTNSAGYHKLKDRIHQLRQEQQLPDKIIYY
LATPPVMYELIPTCLKENGMNVAGSEDGWRRVIVEKPFGTSLESAERLNKHLIHIFDEKE
IYRIDHYLGKETVQNILVLRFSNGIFEPLWNRNYIDSIEISASETLGVENRGKYYDGAGA
LRDMIQNHLMQLMAFTAMESPSVFDPEPIRDEIVKVFRALRPYKTHDMDNLIVRGQYDGY
REEKNVAPDSTTETYVAMKMFIDNWRWSDVPFYIFTGKKLPEKSSEIVVNFKSTPHQLFV
GQCSGGSCNKLIIRIQPDESITLKFGLKMPGAGFTVKQVGMDFRYDSLSKNYLPDAYERL
LLDAMLGDSTLYARSDALEASWRLIDPILHHWKEEGAKNLFFYAPGEDGPIEKAKLGMTP
KDCPCQSCQ