Protein Info for HMPREF1078_RS08635 in Parabacteroides merdae CL09T00C40

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 6 to 476 (471 residues), 602.4 bits, see alignment E=3.2e-185 PF00479: G6PD_N" amino acids 10 to 195 (186 residues), 206.8 bits, see alignment E=4.6e-65 PF02781: G6PD_C" amino acids 197 to 476 (280 residues), 377.1 bits, see alignment E=5.4e-117

Best Hits

Swiss-Prot: 51% identical to G6PD_AGGAC: Glucose-6-phosphate 1-dehydrogenase (zwf) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 79% identity to pdi:BDI_0647)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>HMPREF1078_RS08635 glucose-6-phosphate dehydrogenase (Parabacteroides merdae CL09T00C40)
MKTASNQLLVIFGASGDLTGRKLLPSLYELHVRGLLPERFCILGAARTEYTDDEYRAFEK
VHIRESLKNKEVDDVELDSFLRRVFYLAFDSTNSAGYHKLKDRIHQLRQEQQLPDKIIYY
LATPPVMYELIPTCLKENGMNVAGSEDGWRRVIVEKPFGTSLESAERLNKHLIHIFDEKE
IYRIDHYLGKETVQNILVLRFSNGIFEPLWNRNYIDSIEISASETLGVENRGKYYDGAGA
LRDMIQNHLMQLMAFTAMESPSVFDPEPIRDEIVKVFRALRPYKTHDMDNLIVRGQYDGY
REEKNVAPDSTTETYVAMKMFIDNWRWSDVPFYIFTGKKLPEKSSEIVVNFKSTPHQLFV
GQCSGGSCNKLIIRIQPDESITLKFGLKMPGAGFTVKQVGMDFRYDSLSKNYLPDAYERL
LLDAMLGDSTLYARSDALEASWRLIDPILHHWKEEGAKNLFFYAPGEDGPIEKAKLGMTP
KDCPCQSCQ