Protein Info for HMPREF1078_RS08625 in Parabacteroides merdae CL09T00C40

Annotation: DUF368 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 184 (30 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details PF04018: DUF368" amino acids 18 to 261 (244 residues), 351.1 bits, see alignment E=1.8e-109

Best Hits

KEGG orthology group: K08974, putative membrane protein (inferred from 89% identity to pdi:BDI_1390)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>HMPREF1078_RS08625 DUF368 domain-containing protein (Parabacteroides merdae CL09T00C40)
MKRNLKDYGLLVLKGMGMGAADVVPGVSGGTIAFIVGIYEELIDSIKSINGASLKLLFTG
KIAAFWKAINANFLLSIIAGIGISIFSLAKIITWLLTDHPILVWSFFFGLVLASTWFVSK
DIKKWDWKTILSYIIGIVIAFYITVATPAETPSNLFFIFLCGAIAICAMILPGISGSFIL
VLLGKYFYIMEAVKTFNIPVMLVFICGAAIGITSFSRVLSFALRRFHDITISVLAGFMLG
SLNKVWPWKETIETYTDSHGIVKPLVEANIMPNQLVWEAVGLMVLGYAIVYFLEKLSMKT
SK