Protein Info for HMPREF1078_RS08560 in Parabacteroides merdae CL09T00C40

Annotation: PhoH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF13638: PIN_4" amino acids 7 to 148 (142 residues), 124.4 bits, see alignment E=7.9e-40 PF02562: PhoH" amino acids 232 to 428 (197 residues), 168.9 bits, see alignment E=2.2e-53 PF13604: AAA_30" amino acids 236 to 399 (164 residues), 28.4 bits, see alignment E=2.6e-10

Best Hits

KEGG orthology group: K07175, PhoH-like ATPase (inferred from 88% identity to pdi:BDI_0770)

Predicted SEED Role

"Predicted ATPase related to phosphate starvation-inducible protein PhoH" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>HMPREF1078_RS08560 PhoH family protein (Parabacteroides merdae CL09T00C40)
MGAKKNFVLDTNVILHDYKCIENFQENDIYLPIVVLEELDKFKKGSDQINYNAREFVREL
DTLTSNDLFLKGASLGPGKGTLHVVTGDKYQEKIYQSFPEKTADHRILSCTLSVAESEKD
RKVKTILVTKDVNLRMKARSLGIEVEDYITDKVINVDIFKRAQDIYENIDPDLIDKMYAS
PDGIDADLFDIKSKLEPNECFILKSVRNSVLARYNPFTNKFKKVEKASNYGIQPRNAEQS
FAFEVLNDPDVKLIGLTGKAGTGKTLLALASALKQANVYKQILLARPIVALANKDLGFLP
GDEKQKVAPYMQPLFDNLNVIKGQFAPGGSDARKIDDLQKNGQLVIEALAFIRGRSLSET
FCIIDEAQNLTPHEIKTIITRAGEGTKMVFTGDIQQIDSPYLDAQSNGLAYMVDKMKGQE
LFAHINLIKGERSQLSELASDLL