Protein Info for HMPREF1078_RS08535 in Parabacteroides merdae CL09T00C40

Annotation: sodium:proton antiporter NhaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 361 to 387 (27 residues), see Phobius details amino acids 409 to 436 (28 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details PF03600: CitMHS" amino acids 20 to 392 (373 residues), 115.6 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: None (inferred from 92% identity to pdi:BDI_1199)

Predicted SEED Role

"Na+/H+ antiporter NhaD type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>HMPREF1078_RS08535 sodium:proton antiporter NhaD (Parabacteroides merdae CL09T00C40)
MFILMPVIFVLGILAIALEDKIKINKAAIALFMAISLWMILMFDAYDIFVERSSPLFQEF
LTQNPEMANAPLKDQFITFITNRSIVYHLGNVSETLFFVMCSMLIVDIVDKHGGFRAVTG
YIRTANKRKLLWYISFAAFFFSALLDNLAAAIVIMAVLRKLVPDRTDRLKYACMVIIAAN
AGGSWSPIGDVTTILLWVGKNVTAMHQISHVFFPALINLLVPLTIANFWLFKKDATLRVM
SEEEMADEYAPEIPNHSRRVIFVIGVLSLALVPVFQMVTDLPPFLGVLLGLVVLWFYTDI
MYSKLHMHESNKLRISQLLPNIDLATIFFFLGILMAVGALETSGQLGLMSAFLDKHVHEP
YLISFVIGVLSSCVDNVALVAATMGMYPIVPDAANLTPYAQFFVSDGGFWTFLAYCAVTG
GSILIIGSATGVTVMGLEKIDFMYYTKRFSILALIGYCCGAGVYMLLFA