Protein Info for HMPREF1078_RS08495 in Parabacteroides merdae CL09T00C40

Annotation: proline--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to SYP_PARD8: Proline--tRNA ligase (proS) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 94% identity to pdi:BDI_0989)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), archaeal/eukaryal type" (EC 6.1.1.15)

MetaCyc Pathways

tRNA charging (21/21 steps found)
pyoluteorin biosynthesis (1/7 steps found)
ergotamine biosynthesis (4/12 steps found)
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
clorobiocin biosynthesis (1/10 steps found)
superpathway of ergotamine biosynthesis (5/18 steps found)
pyrrolomycin biosynthesis (1/14 steps found)
sulfazecin biosynthesis (1/16 steps found)
phosalacine biosynthesis (2/25 steps found)
phosphinothricin tripeptide biosynthesis (2/25 steps found)
colibactin biosynthesis (7/38 steps found)

KEGG Metabolic Maps

Aminoacyl-tRNA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>HMPREF1078_RS08495 proline--tRNA ligase (Parabacteroides merdae CL09T00C40)
MAKELKELTPRSVNYSQWYQDLVIKADLAENSAVRGCMVIKPYGYAIWEKMQRILDDMFK
ETGHVNAYFPLLIPKSFLSKEAEHVEGFAKECAVVTHYRLKTNHDGTGVVVDPAAKLEEE
LIIRPTSETIIWNTYRNWIQSYRDLPILCNQWANVMRWEMRTRLFLRTAEFLWQEGHTAH
ATREEAEIEAKKMQGVYADFAENYMAMPVIKGVKSASERFAGALDTYTIEAMMQDGKALQ
AGTSHFLGQNFGKAFDVTFIDKNGKSDYAWATSWGVSTRLIGALIMSHSDDNGLVLPPHL
APIQVVIIPIYRSEEQLAQISEKVNGIVAKLKALGISVKFDDADNKKPGWKFAEYELKGV
PVRLAMGGRDLENNTIEVMRRDTLEKETVTCDNIETYVQNLLEEIQKNIFQKALDHRTEK
TITVDTYEEFKEKIEEGYFIMAHWDGTPETEEQVKNETKATIRCIPLEGDKTPGKCMVTG
RPSAQRVLFARAY