Protein Info for HMPREF1078_RS08490 in Parabacteroides merdae CL09T00C40

Annotation: phosphoglycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 91% identical to PGK_BACTN: Phosphoglycerate kinase (pgk) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 94% identity to pdi:BDI_0672)

MetaCyc: 47% identical to phosphoglycerate kinase ([Candida] boidinii)
Phosphoglycerate kinase. [EC: 2.7.2.3]

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

superpathway of glucose and xylose degradation (16/17 steps found)
glycolysis III (from glucose) (11/11 steps found)
formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
homolactic fermentation (11/12 steps found)
glycolysis II (from fructose 6-phosphate) (10/11 steps found)
glycolysis IV (9/10 steps found)
superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
gluconeogenesis I (11/13 steps found)
glycolysis I (from glucose 6-phosphate) (11/13 steps found)
Entner-Doudoroff pathway I (8/9 steps found)
gluconeogenesis III (10/12 steps found)
Bifidobacterium shunt (12/15 steps found)
superpathway of N-acetylneuraminate degradation (16/22 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
glycolysis VI (from fructose) (8/11 steps found)
heterolactic fermentation (13/18 steps found)
Calvin-Benson-Bassham cycle (9/13 steps found)
sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
superpathway of anaerobic sucrose degradation (13/19 steps found)
superpathway of hexitol degradation (bacteria) (12/18 steps found)
superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (17/26 steps found)
ethene biosynthesis V (engineered) (16/25 steps found)
oxygenic photosynthesis (10/17 steps found)
glycerol degradation to butanol (8/16 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (13/26 steps found)
1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>HMPREF1078_RS08490 phosphoglycerate kinase (Parabacteroides merdae CL09T00C40)
MQSIDNFNFAGKKAFVRVDFNVPLDENFNITDDTRIRAALPTLKKILADGGSVIIGSHLG
RPKGVTDKYSLKHILKHVSELLGVDVQFANDCIGEEAGAKAAALQPGEALLLENLRFYAE
EEGKPRGLAEDATDEEKKAAKKAVKESQKEFTKRLASYADCYVNDAFGTAHRAHASTALI
ADYFDTDHKMFGYLMEKEVKAVEKVLNDITRPFTAIMGGSKVSSKIEIIENLLNKVDNLI
ITGGMTYTFTKAMGGKIGKSICEDDKLDLALDLMKKAKEKGVNLVLAIDAKIADDFSNDA
KTAYADVNEIPDGWEGLDIGPKTIALYAEVIKNSKTILWNGPTGVFEFENFTDGSRAVGE
AIVEATKNGAFSLVGGGDSVACVNKFGLASGVSYVSTGGGALLEAIEGKVLPGIAAVKGE
AYK