Protein Info for HMPREF1078_RS08090 in Parabacteroides merdae CL09T00C40

Annotation: ClC family H(+)/Cl(-) exchange transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 361 to 387 (27 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 71 to 411 (341 residues), 245.4 bits, see alignment E=1e-76 PF02080: TrkA_C" amino acids 443 to 505 (63 residues), 32.5 bits, see alignment E=6.3e-12

Best Hits

KEGG orthology group: None (inferred from 70% identity to bfr:BF1240)

Predicted SEED Role

"Voltage-gated chloride channel family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>HMPREF1078_RS08090 ClC family H(+)/Cl(-) exchange transporter (Parabacteroides merdae CL09T00C40)
MKINRIVKLKLVDARLYFVSLIVGLLTGLVAVPYHYLLQLFFNMRKNFFQSSPPWYYHIV
LFLALWGILCFVARMARRWPYIGGGGISQTRGVINGRIEYAHSFRQLLAKFAGGVLTLSS
GLSMGREGPSVQMGSYIGDLVSKWGHILSGERKQLLAAGAGAGLAAAFAAPLAAATLVIE
SIERFDAPKTAITTILAGVVAGAIASTIFPINPYHDIQAIVPDLSMGLHIKLYILFAVIV
SVFGKLYSLLMLYAKRMYPAIRQPEYIKLLGLLGMAYIISLTVTDLTGGGEQFLMQQAEG
GNSNIYWIAGMMFLHMVFTVFSFSSGLPGGNFIPTLVTGGLTGKLYALILVQHGIVRMES
VSYVMLIGMGAFLVAVVRTPITAIILITEITGHFEVFYPSIVVGGLTYYFTELLGIKPFN
VMFYEEMINKPAFREQKRLTLDVEVMAGAYFDRKEVDTLELPNHCIIMNIHRDRKDISPT
GQTILPGDQLTIELDAQDIEKLYEPLVSMANIY