Protein Info for HMPREF1078_RS08075 in Parabacteroides merdae CL09T00C40

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01136: cysteine synthase" amino acids 7 to 306 (300 residues), 450 bits, see alignment E=4e-139 TIGR01139: cysteine synthase A" amino acids 7 to 306 (300 residues), 460.4 bits, see alignment E=2.6e-142 PF00291: PALP" amino acids 7 to 295 (289 residues), 263.9 bits, see alignment E=9.6e-83

Best Hits

Swiss-Prot: 60% identical to CYSK_SPIOL: Cysteine synthase from Spinacia oleracea

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 88% identity to pdi:BDI_0970)

MetaCyc: 60% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>HMPREF1078_RS08075 cysteine synthase A (Parabacteroides merdae CL09T00C40)
MIAKKLTDLIGNTPLLEFSNFNASKGLKAKVIGKLEYFNPAGSVKDRIALAMIEDAEEKG
LLKPGATIIEPTSGNTGVGLAFVSAAKGYKLVLTMPETMSLERRNLLKALGANLILTPGT
EGMKGAIAKAEALRDETPGSIILQQFENPANPARHAKTTAQEIWRDTDGKVDIFVAGVGT
GGTVSGVGKGLKAHNPDVKIVAVEPTDSAVLSGGKPGPHKIQGIGAGFIPKTYDSSVVDE
IIQVEGDDAIRTSRELAQKEGLLVGISSGAAVYAAVQLARLPENEGKTIVALLPDTGERY
LSTALYAFEEYPL