Protein Info for HMPREF1078_RS08070 in Parabacteroides merdae CL09T00C40

Annotation: isochorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00543: isochorismate synthase
  • amino acids 88 to 366 (279 residues), 264.6 bits, E=7.2e-83
• PF00425: Chorismate_bind
  • amino acids 112 to 359 (248 residues), 199 bits, E=5.4e-63

Best Hits

KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 59% identity to pdi:BDI_1135)

Predicted SEED Role

"Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2)" (EC 5.4.4.2)

MetaCyc Pathways

• superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (7/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (5/7 steps found)
• salicylate biosynthesis II (2/3 steps found)
• superpathway of menaquinol-10 biosynthesis (7/10 steps found)
• superpathway of menaquinol-11 biosynthesis (7/10 steps found)
• superpathway of menaquinol-12 biosynthesis (7/10 steps found)
• superpathway of menaquinol-13 biosynthesis (7/10 steps found)
• superpathway of menaquinol-6 biosynthesis (7/10 steps found)
• superpathway of menaquinol-7 biosynthesis (7/10 steps found)
• superpathway of menaquinol-9 biosynthesis (7/10 steps found)
• salicylate biosynthesis I (1/2 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (6/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (6/9 steps found)
• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• superpathway of phylloquinol biosynthesis (6/15 steps found)
• superpathway of chorismate metabolism (37/59 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• bacillibactin biosynthesis (3/12 steps found)
• enterobactin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of siderophore group nonribosomal peptides
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Protein Sequence (373 amino acids)

>HMPREF1078_RS08070 isochorismate synthase (Parabacteroides merdae CL09T00C40)
MTPDELRICNVVDTLIRKNRSFALWRIPGESPRFAMQTSGSARILYHIEELDEQSGFVIA
PFHVSKQHPIVLIRPDIQKLPPDEETKVSYSMPAEQEFHHSETLVSFPENPKEDYSRRFN
AFIEPLRRKQFEKLVLSRCQTIPADRANFSPAAAFLKATGRYKYSYVYLCHTPATGTWLG
CTPEIILSGEKGKWHTVALAGTQPLQNGELPIEWDDKNREEQEYVAFYIRKQLQALGIKP
TETPPIPVRAGELSHLRSDFSFPLPDNKKLGELLKRLHPTPAVCGLPKEETYRFIRENEG
YDRSYYSGFIGWLAPEGKSDLYVNLRCMNILPGSFVLYAGGGILASSEIESEWLETEAKM
QTMKRLINSIDKS